About Products Protein Database Contact

Protein expression services for fsr5 | Short-chain dehydrogenase/reductase fsr5

Description
Short-chain dehydrogenase/reductase; part of the gene cluster that mediates the biosynthesis of fusarubins, highly pigmented naphthoquinones responsible for the coloration of the fruiting bodies (PubMed:22492438, PubMed:23825955). The non-reducing polyketide synthase FSR1 is responsible for the condensation of seven acetyl-CoA units to yield a haptaketide (PubMed:22492438). After rings A and B are formed by aldol-type cyclization, the PKS-derived product is released as 6-O-demethylfusarubinaldehyde (PubMed:22492438). Then, two hydroxyl groups at C-5 and C-10 are incorporated by FSR3, and simultaneously hydroxyl groups at C-6 and C-8 are methylated by FSR2 (PubMed:22492438). The aldehyde is, on the one hand, reduced by FSR3 to 8-O-methylfusarubin alcohol, which equilibrates mainly with 8-O-methylfusarubin and only small amounts of 8-O-methylnectriafurone (PubMed:22492438). On the other hand, the aldehyde can be oxidized to form 8-O-methylfusarubinic acid, a reaction driven by FSR3 equilibrating with 8-O-methylfusarubinlactone, finally resulting in 8-O-methylanhydrofusarubinlactol after a further reduction step and loss of water (PubMed:22492438). 8-O-Methylfusarubinic acid can also undergo decarboxylation, resulting in 8-O-methyl-13-hydroxynorjavanicin after another hydroxylation step at C-13 (PubMed:22492438). Both steps are most likely also accomplished by FSR3 (PubMed:22492438). No enzymatic function has been determined so far for either FSR4 and FSR5 (PubMed:22492438). Their deletion does not alter the product spectrum, but the possibility that they catalyze specific enzymatic steps during perithecium development cannot be ruled out (PubMed:22492438). FSR4 might possess a regulatory function in the biosynthesis of fusarubins (PubMed:22492438).
Family
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Species
Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Length
265 amino acids
Sequence
MASLGKYVSKLAGSRVLVIGGSSGIGFGVAEAAIQNGASSVFISSSSQTKISSAIERLKENNQSAKAQLHGFPCNLGSPDTLTSEVENLFAEVAKSGKLDHVVFTAGDKLAVGKLEDFTLDAIRQAGTVRFFAPLVVAQQLRKHLDESGSSSFTVATGGATEHVSKDWSIMYSYLSGLRGMIRGLAVDLAPIRVNAVAQGPTDTEIWSYVKEMGYWDNVTGHLKGRMTTGEIGKVEDVVEAYLYLMKNKNTSGSVVETTGGTLLS
Mass
28.1 kDa
Simulated SDS-PAGE
Western blot of fsr5 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make fsr5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here