Short chain dehydrogenase; part of the gene cluster that mediates the biosynthesis of the phytotoxin solanapyrone, a causal agent of early blight disease of potato and tomato (PubMed:20486243). The prosolanapyrone synthase sol1 is a polyketide synthase that produces the octaketide desmethylprosolanapyrone I via sequential condensations of 7 malonyl-CoA units with one acetyl-CoA unit, and one methylation step (PubMed:20486243). The octaketide backbone is further methylated by the sol2 O-methyltransferase to yield prosolanapyrone I (PubMed:20486243). Prosolanapyrone I is hydroxylated to prosolanapyrone II by the cytochrome P450 monooxygenase sol6 (PubMed:20486243). The solanapyrone synthase sol5 then catalyzes the oxidation of prosolanapyrone II and the subsequent Diels Alder cycloisomerization of the product prosolanapyrone III to solanapyrones A and D (PubMed:9659400, PubMed:18256508). Solanapyrones A and D are then converted into solanapyrones B and E, respectively, by the sol3 dehydrogenase (PubMed:20486243).

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

285 amino acids

MGGMLGFFVRQLTFMPKPLPQNVRLDGKTAIVTGANVGLGLEASKEMASHGLARVILGVRTVSKGEAAKQEILKQSPNCDVQVWPVDHESFESMVAFGERAQSLDRLDIVILCAGVKNLVFSLSKTGHEQNVQVNHLGTSLLSLLLLKPLKDTAAKTGSPSRLTIVASEVHFWTPFDERKAPSILARLDEKDSFRGMERYNTSKLLNILWMRELSSRVTGNVVINAVNPGLCASALHRTDPTPGLAYLNKIFAWTPAQGGHNLTYAATQHVDEPGAYLSEQHLEK

31.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sol3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here