The major fimbrial subunit. Interacts with alpha-sialic acid-(2-3)-beta-Gal containing receptors. It belongs to the group of Mrh (Mannose-resistant hemagglutination) fimbrial proteins.

Belongs to the fimbrial protein family.

181 amino acids

MKLKFISMAVFSALTLGVATNASAVTTVNGGTVHFKGEVVDAACAVNTNSANQTVLLGQVRSAKLANDGEKSSPVGFSIELNDCSSATAGHASIIFAGNVIATHNDVLSLQNSAAGSATNVGIQILDHTGTAVQFDGVTASTQFTLTDGTNKIPFQAVYYATGKSTPGIANADATFKVQYQ

18.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sfaA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here