Transcriptional regulator that controls a genetic switch in male development. It is responsible for initiating male sex determination. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Promotes DNA bending (By similarity).

Belongs to the SRY family.

216 amino acids

MFRIVNGEDYSPAVQQRNILDFGKAPSLLWTDNGSSNDRCDTGGNGRESGQDRVKRPMNAFIVWSRDQRRKVALENPQMQNSEISKRLGYDWKMLTEAEKQPFFEEAQRLRAMHRDKYPGYKYHPRRKPKRPQESLPADSSVLCSRTHIEETLYPFTYKDGCAKATRSRMESQLSHSQPTNISSSLLPQEHRSSWTILRHNRVTQATQTCGRPLLL

25 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SRY using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here