Adapter protein which modulates signaling mediated by several receptor tyrosine kinases such as egl-15 and let-23 probably acting upstream of let-60/ras. Negatively regulates vulva induction probably downstream of let-23 (PubMed:1372395, PubMed:16547100). Involved in sex myoblast migration (PubMed:1372395, PubMed:9073451). Negatively regulates fluid homeostasis probably downstream of egl-15 (PubMed:1372395, PubMed:11689700). During the formation of neuromuscular junctions at the larval stage, negatively regulates membrane protrusion from body wall muscles probably downstream of egl-15 (PubMed:16495308). Involved in cytoskeleton dynamics and is recruited by mig-13 to the leading edge of Q neuroblasts and their descendants to signal downstream to activate the wsp-1 pathway and direct migration along the anteroposterior body axis during larval development (PubMed:27780040). Involved in let-23-mediated regulation of fertility independently of let-60/Ras (PubMed:16547100). Negatively regulates daf-2-mediated repression of dauer formation (PubMed:16547100). Plays a role in nicotinic acetylcholine receptor (nAChR)-mediated sensitivity to nicotine (PubMed:15990870). Regulates synaptic levels of nAchR subunit lev-1 in the nerve cord (PubMed:15990870). May play a role in oocyte development upstream of let-60/Ras and the MAP kinase pathway (PubMed:12169634).

Belongs to the GRB2/sem-5/DRK family.

228 amino acids

MEAVAEHDFQAGSPDELSFKRGNTLKVLNKDEDPHWYKAELDGNEGFIPSNYIRMTECNWYLGKITRNDAEVLLKKPTVRDGHFLVRQCESSPGEFSISVRFQDSVQHFKVLRDQNGKYYLWAVKFNSLNELVAYHRTASVSRTHTILLSDMNVETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYNSNKSNSNVAPGFNFGN

26.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sem-5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here