Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation (By similarity).

Belongs to the SCM family.

329 amino acids

MMSDSSSEIDVVKTRIPTYDEDDNTILYAYETKPEFVNKEPNIVSDASCNTEEQLRTVNDVLLHCQVIYDALQNLDKKTDVIRRKVSKIQRFYARSLWTNRKRSGYKKHSYRPVKKLKLQKMKKNEVYETFSYPQSYSPTLPVSRRENNSPSNLPRPPFCMEEYQRAEPEEDPILSRTPSPVHPSDFCEHNYQSYYASDGAMYGSSSGLCLGNPRADSIHNTYSTDHASAVSPSVTRSPVGNDGCIAEGNITKHPSTWSVEAVVLFLKQTDPVALCPLVDLFRSHEVDGKALLLLTSDVLLKHFGVKLGTAVKLCYYIDRLKQGKCFEN

37.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SCML1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here