Protein expression services for SERPINA3-1 | Serpin A3-1
Description
Potent inhibitor of the serine proteases elastase and trypsin. Moderately inhibits the serine proteases plasmin and chymotrypsin, and the thiol protease proenkephalin-processing enzyme. Does not inhibit the serine proteases cathepsin G, furin, kallikrein, thrombin, tissue plasminogen activator and urokinase, or the cysteine proteases cathepsin B, cathepsin L and papain.
Family
Belongs to the serpin family.
Species
Bos taurus
Length
411 amino acids
Sequence
MRAERTSFLLALGLLVAGIRSVHCLPENVVVKDQHRRVDGHTLASSNTDFAFSLYKQLALKNPNKNVILSPLSVSIALAFLSLGARGSTLTEILEGLKFNLTEIQEKEIHHSFQHLLQALNQPSNQLQLSVGNAMFVQEELKLLDKFIEDAQVLYSSEAFPTNFRDSEAARSLINDYVKNKTQGKIEELFKYLSPRTELVLVNYIYFKAQWKTPFDPKHTEQAEFHVSDNKTVEVPMMTLDLETPYFRDEELGCTLVELTYTSNDSALFILPDEGKMRDLEAKLTPETLTRWRNSLQPRRIHELYLPKFSIKSNYELNDILSQLGIRKIFANADLSGITGTADLVVSQVVHGAALDVDEEGTEGAAATGISMERTILRIIVRVNRPFLIAIVLKDTQSIIFLGKVTNPSEA
Mass
46.2 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make SERPINA3-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here