An odorant receptor which affects chemotaxis to the volatile odorant diacetyl. Specifies AWA neuronal cell fate via the odr-7 pathway (By similarity).

Belongs to the nematode receptor-like protein str family.

342 amino acids

MTGELWLTLVDTADIVGFSMTFCVNIVLLFLLKNRGKNLGTYKHLMAFFSVFSIFYAIIESILRPIMHIENATFFLISRKRFNYSTRLGKINSAFYCACFATSFVVSGVHFVYRFFASCKPHLLRSFNMPYLLLWPLGCSIPVMMWASVSYFLYPDTAFTEAAVTNVLNTHYHSIKKDNVSYIAYVYYQYDENGVRYVYLKNLLGCFVHYFVMSATFVVMFICGYLTWKTMRKHKTASDRTRQLQKQLFKALVLQTLIPTIFMYAPTGVMFIAPFFSINLNANANFIVFCSFLYPGLDPLILILIIRDFRQTVFKFFCLRKKNSVDESRSTTRANMSQVATH

39.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make odr-10 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here