PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for PP2A-like phosphatases modulating their activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2Ai) in presence of ATP and Mg(2+) by dissociating the inactive form from the complex (By similarity).

Belongs to the PTPA-type PPIase family.

247 amino acids

MKNGIDFVETEAYARIYNFILMVDDSIKNSEQRQSKHHMDVLADITRIVSETEKDPSPQRYANMAAKTVFKKIYDTYDDEYLRNSFGNQIRLDYGTGHELNFLCYLYAQYCRGSIGIDCVFTILVKYFEIVRLFITKFNLEPAGSHGMWGLDDYQFLPFLFGSSELCNTTLRFDELDGSKCYFVAVEKKLGGSSRILKSIMDKDWASINRGMIRMYDDHVLRRSVVTQHFIYGEYLRKDRSQANKDL

28.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ECU06_0720 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here