Involved in regulation of actin cytoskeleton organization during cell motility; F-actin fragmenting and capping protein allowing dynamic rearrangements of the actin cytoskeleton. Also part of a regulatory pathway from the centrosome to the midzone, thus regulating the completion of cell division.

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.

478 amino acids

MASKKGDPEELYVRQEKIGKGSFGEVFKGINKKTNETIAIKTIDLEDAEDEIEDIQQEINVLSQCESPFVTKYFGSFLKGSKLWIIMEYLAGGSVLDLMKPGPFDEGYIAIILRELLKGLEYLHSEGKIHRDIKAANVLLSASGDVKLADFGVSGQLTDQMTKRNTFVGTPFWMAPEVIKQTGYDSKADIWSMGITALEMAKGEPPRADLHPMRALFLIPKDPPPTLEGNFSKGFKEFCALCLNKDPNQRPTAKDLLKHKFIKAAKKTSSLTDLIERRQKWLQLNGNNADDENDDLDRDAKSNEEDFGWEFPTIKQKSPVAVQEQQQTPQKPTVVSTPIKEQQQQQQPTPVTTPQQPVTTTTTTPTTETKVRSLSNSSQTTPVKTTVAATTAPATTPASNAPTSTTPNGAAVTQQQAPRASALTSVIYPVLSKLLKNTSDENVINALAQLKMAFDNAEKAKPGITHSLIAQIIETLKR

52.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make svkA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here