Protein expression services for RIPK | Serine/threonine-protein kinase RIPK
Description
Serine/threonine-protein kinase involved in disease resistance. During Pseudomonas syringae infection, and in response to the bacterial effectors AvrB and AvrRpm1, RIPK phosphorylates the host target RIN4, which subsequently activates RPM1-dependent effector-triggered immunity (ETI) (PubMed:21320696, PubMed:25625821). Seems to act as negative regulator of plant basal defense responses and may play a role in pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) (PubMed:21320696). Required for the bacterial XopAC/AvrAC effector-triggered immunity against Xanthomonas campestris (PubMed:23951354).
Family
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Species
Arabidopsis thaliana
Length
462 amino acids
Sequence
MAVKKKVSWRSLIVGCLGDPETLMASSKKPKRKNDVIKKQSSFQRLSILDMSNPSSNTLSEDLSISLAGSDLHVFTLAELKVITQSFSSTNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLEGLQGHREWLTEVMFLGQLKHKNLVKLIGYCCEEEHRTLVYEFMPRGSLENQLFRRYSASLPWSTRMKIAHGAATGLQFLHEAENPVIYRDFKASNILLDSDYTAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYIMTGHLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLSRIMDPRLEGQYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKDYNDIPMGTFTYTVPNTPDNKEDDGRVGNKPRKSSHHHHHQQQQSNHPRSSPSPTTKSPSPTAKSPRNSTENHRRTLRNGVNSPLRSEAGGERY
Mass
51.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make RIPK using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here