Description
Plays a role in pre-mRNA splicing. Involved in both constitutive and alternative pre-mRNA splicing. May have a role in the recognition of the 3' splice site during the second step of splicing (By similarity).
Sequence
MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRSRSRGRGKPYRVQRSRSKSRTRRSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDKEKREKEKDKGKDKEVHSIKRGDSGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALKAKERSEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKDVKKAVEPSEVQHVTAASGPASAAAEPPSTGKEIDPDSIPTAIKYQDDNSLAHPNLFIEKAEAEEKWFKRLIALRQERLMGSPVA
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service