Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference (By similarity).

Belongs to the SPTSS family. SPTSSB subfamily.

80 amino acids

MDVKHIKDYLSWLYYQYLLITCSYVLEPWEQSIFNTLLLTIIAMVIYSSYIFIPIHVRLAVEFFSRIFGGQHESTVALMS

9.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sptssb using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here