About Products Protein Database Contact

Protein expression services for Sptssb | Serine palmitoyltransferase small subunit B

Description
Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference, complexes with this subunit showing a clear preference for longer acyl-CoAs. The SPTLC1-SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference.
Family
Belongs to the SPTSS family. SPTSSB subfamily.
Species
Mus musculus
Length
76 amino acids
Sequence
MDFKRVKEYFAWLYYQYQIITCCAVMEPWEQSMLNTIILTIVAMVVYTAYVFIPIHIRLAWEFFSKICGYDSSISN
Mass
9.1 kDa
Simulated SDS-PAGE
Western blot of Sptssb recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Sptssb using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here