Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium. Required for the progression through mitosis through regulation of chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements including convergent extension during gastrulation. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Controls cell shape and not polarization of cells during convergent extension (By similarity).

Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.

350 amino acids

MSQTGEKVKFSDSAGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERYIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINSQDCFKTIIHYIDNQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVEFMKALHGKVNIVPVIAKADTLTLKERDRLKRRVLDEIAEHGIRIYQLPDADSDEDEEFKEQTRVLKASIPFAVIGSNQLIEVKGKKIRGRLYPWGVVEVENPEHNDFLKLRTMLVTHMQDLQEVTQDLHYENFRSERLKRTGKPVEEEVLDKDMILQQKEAELRRMQEMIAQMQAQMRMKPSGEE

40.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make sept2-A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here