About Products Protein Database Contact

Protein expression services for sept2-A | Septin-2A

Description
Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium. Required for the progression through mitosis through regulation of chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements including convergent extension during gastrulation. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Controls cell shape and not polarization of cells during convergent extension (By similarity).
Family
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.
Species
Xenopus tropicalis
Length
350 amino acids
Sequence
MSQTGEKVKFSDSAGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERYIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINSQDCFKTIIHYIDNQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVEFMKALHGKVNIVPVIAKADTLTLKERDRLKRRVLDEIAEHGIRIYQLPDADSDEDEEFKEQTRVLKASIPFAVIGSNQLIEVKGKKIRGRLYPWGVVEVENPEHNDFLKLRTMLVTHMQDLQEVTQDLHYENFRSERLKRTGKPVEEEVLDKDMILQQKEAELRRMQEMIAQMQAQMRMKPSGEE
Mass
40.3 kDa
Simulated SDS-PAGE
Western blot of sept2-A recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make sept2-A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here