About Products Protein Database Contact

Protein expression services for Septin12 | Septin-12

Description
Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential). Involved in spermatogenesis. Involved in the morphogenesis of sperm heads and the elongation of sperm tails probably implicating the association with alpha- and beta-tubulins. Forms a filamentous structure with SEPTIN7, SEPTIN6, SEPTIN2 and probably SEPTIN4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation (By similarity).
Family
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.
Species
Rattus norvegicus
Length
356 amino acids
Sequence
MDERRTPSPCSSRPSSPRTPPCEMFGPVGIEAVLDQLRIKAMKTGFEFNIMVVGQSGLGKSTMVNTLFKSKVWQSPAPNLDVPMPQTLELHSVTHVIEEKGLKLKLTVTDTPGFGDQINNDKCWDPILSYINQQYEQYLQEELLITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLRRLCRTVNVVPVIARADSLTIEERDAFRSRIQQNLKNHCIDVYPQQCFDEDINDRLLNSKIREQIPFAVVGADREHIVNGRCVLGRKTKWGIIEVENMAHCEFLLLRDLLIRSHLQDLKDITHNVHYENYRVLRLNESHVLPRGPGWVNLAPASPGQLMAPGPEKVRKRSKDPRDDEC
Mass
40.8 kDa
Simulated SDS-PAGE
Western blot of Septin12 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Septin12 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here