Member of the two-component regulatory system NtrB/NtrC, which controls expression of the nitrogen-regulated (ntr) genes in response to nitrogen limitation. Under conditions of nitrogen limitation, NtrB autophosphorylates and transfers the phosphoryl group to NtrC. In the presence of nitrogen, acts as a phosphatase that dephosphorylates and inactivates NtrC.

383 amino acids

MTKDTTSPPDQAGGTVAMAVLNAIQNPVVMVDESGFIAFANWEAEAFFGAAFASGALPDLDIHSFGSPLLALVDQVRTQGSPVNEYRVDLSSPRLGQDKLVDLYVAPVLSEPGGVVIVFQERSMADKIDRQLTHRAAARSVTGLASSLAHEIKNPLSGNRGAAQLLEQSVIDDDRALTRLICDETDRIVSLVDRMEVFSDERPVRRMPVNIHSVLDHVKRLAQSGFARNIRITESYDPSLPAVYANRDQLVQVFLNLVKNAAEAVGDRPDGEIMLTTAYRPGIRLSVAGTREKISLPLEFCVHDNGPGVPADLLPHLFDPFITTKTNGSGLGLALVAKIIGDHGGIIECDSQNSRTTFRVLMPASKDASLEDASSASSTGPSR

41.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ntrB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here