May function as an inhibitory cotransmitter acting in conjunction with the fast excitatory transmitter released by sensory neurons. The peptide selectively inhibits certain postsynaptic cells probably by means of sensorin A release.

113 amino acids

MPSRAATSPLNVQMMVVLCIVCLALQAVAANATRSKNNVPRRFPRARYRVGYMFGKRSSSETYSTNLINLLSRQLVSQEELRAILEKQPILLDEVVKILDRNDDGYITVADLL

12.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PSC1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here