Description
Member of the two-component regulatory system CopS/CopR. Involved in the activation of copper resistance gene operon copABCD. Specifically recognizes or transduces a signal only in response to copper. This would lead to phosphorylation of CopR in the cytoplasm. CopS/CopR may also regulate chromosomally encoded genes. May also be involved in basic copper metabolism.
Species
Pseudomonas syringae pv. tomato
Sequence
MKPGSLTLRLSLLFVVAVAAVLIIVGVAFNELSRHHFRALDAQALGEKLEAITQIAKESGANPELLKARWHTLLGAHPDLSAVFLKTDGTPFFAEPPQSAVPSLAQATQRDGVWEWEKEGRMFRALTASVSLPTASPPLTAWLVLDVTTHMHFFAMLERWFWGVLLASTVLSAALGWLVAKNGLRPVARVTQTAASMSAGSLKERIPLEPVPDELRALITAFNSMLGRLDDSFMRLSNFSADIAHELRTPISNLRTHTEVILAKKRAPEVYEENLSSNLEELNRLSGIIDGMLFLAKSDNGLIVPEAVELDLRTVISKLFGYYEFLAEDKGIQLQASGNASIFADSVMIDRVVSNLLSNALRYTSSGETIKVSIHDHGGRVELRLENPGPEIVPQHLDRIFDRFYRVDPARREGRECGAGASDCPVLDASAWRHYLVYIPRGPNDLHPHLHAIACPTNLTCRPDSLGTAKPGHTRLGEHETGCHCAG
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service