Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner (By similarity).

Belongs to the selenoprotein S family.

193 amino acids

MELGNQPGPGNRPEIELEWYQYVQNTVGWALASYGWYILFGCIILYFLIQKLSANFTRAGASTHTTVTDPDEIVRRQEAVTAARMRMQEELNAQAELYKQKQVQLQEEKRRRNIETWDRMQEGKSSKVACRLGQDASPSTSASSSPSTSSSAPKPKPERKPLRGSGYNPLTGDGGSTCAWRPGRRGPSSGGUG

21.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make vimp-a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here