Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

Belongs to the selenoprotein P family.

402 amino acids

MWRGLGLALALCLLLTGGTESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASUYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLURKRCINQLLUQFPKDSESALSSCCCHCRHLVFEKTGSAITUQCTEKLPSLCSUQGLLAEENVIESUQURLPPAAUQAAGQQLNPTEASTKUSUKNKAKMUKUPSN

45.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SELENOP using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here