May function as a thiol-disulfide oxidoreductase that participates in disulfide bond formation. Involved in the regulation of reproduction during the period of rapid gonadal development.

Belongs to the selenoprotein M/F family.

129 amino acids

MARGLAVFFLLAGACLALAEDVVDKGVAKARVESCSGUQLNRYPGAKQFIQEDLPLFHNTKFQHIGGAAPELLLLNKQDQELERFDLKKLSREEINELMIKKGFYKKSSKDEQVPEEYQEGPYMEKEEL

14.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Selenom using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here