Required for the calcium-dependent exocytosis of signal sequence-containing cytokines. Probably acts in cooperation with the SNARE machinery (By similarity).

Belongs to the SCAMP family. SCAMP5 subfamily.

235 amino acids

MSDKPNNFPPLPRFIPLKPCFYQDFDTDIPDLHRTTAKRLYYLWMLNSITLGVNLIGCLAWLIGGGSATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFNFMAFFFTFTAQLVISIIQAVGIPGWGVCGWIASISFFGTNVGSAVVMLIPTIMFTAVAVLSFVALTKVHRFYRGAGGSLSKAQEEWTTGAWKNPHVQQAAQNAAFGATQGAMTQNEPQYSATPNYGYSNEM

26.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make scamp5-a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here