Description
Member of the granin protein family that regulates the biogenesis of secretory granules (PubMed:16219686). Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA (PubMed:12388744). May also play a role in angiogenesis (PubMed:28330905). Promotes endothelial proliferation, migration and tube formation through MEK/ERK signaling pathway (By similarity).
Sequence
MGFLWTGSWILVLVLNSGPIQAFPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKAFPSESKPSESNYSSVDNLNLLRAITEKETVEKERQSIRSPPFDNQLNVEDADSTKNRKLIDEYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRGVFDKIVSKLLNLGLITESQAHTLEDEVAEALQKLISKEANNYEETLDKPTSRTENQDGKIPEKVTPVAAVQDGFTNRENDETVSNTLTLSNGLERRTNPHREDDFEELQYFPNFYALLTSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDETIALQTKNKLEKNTTDSKSKLFPAPPEKSQEETDSTKEEAAKMEKEYGSLKDSTKDDNSNLGGKTDEATGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKGILDKEEANAIKRIYSSL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service