Member of the granin protein family that regulates the biogenesis of secretory granules (By similarity). Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA (By similarity). May also play a role in angiogenesis. Promotes endothelial proliferation, migration and tube formation through MEK/ERK signaling pathway (By similarity).

471 amino acids

MGFLWTGTWIVVLMLHSSPIQAFPKPAGSQDKPLHNRELSAERPLNEQIAEAEADEIKKTYPPENKPGESNYSFVDNLNLLKAITEKEKNEKERQSVKISPNDNKLNVEDVDSTKNRRLIDDYDSTKSGLDRKFQDDPDGLHQLDGTPLTAEDIVQKIATRIYEENDRGVFDRIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEELNKPTSKTESQTGKIPEKVTPMAAIQDAFTNGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDETIALQTKNKLEKNVTDNKSKLFAVPSEKSHEETDSTKEEAAKMEKEYGTLKDSTKDDDSNPRGKTDEHKGKTEAYLEAIRKNIDWLKKHNKKENKEDYDLSKMRDFINQQADAYVEKGILDKEEADAIKRIYSSL

53.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SCG3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here