Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appears to be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bone development.

Belongs to the secreted frizzled-related protein (sFRP) family.

315 amino acids

MWRGLPALALAALLLLGRAPAGRAAACEPVRIPLCKPLPWNMTKMPNHLHHSTQANAVLAMEQFEGLLGTNCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARAGCEPVLIRYRHAWPESLACDELPLYDRGVCISPEAIVTAEGADFPMDSNNGNCRGTGIERCKCKPIKATQKTYLRNNYNYVIRAKVKEVKTKCHDVTAVVEVKEILKSSLVNIPKDTVNLYTNSGCLCPPLSANEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDQKLRHLGKGKGEPGQSDSALKTGKPGNARQTRS

35 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FRZB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here