Secreted aspartic protease; part of the gene cluster that mediates the biosynthesis of the mycotoxin fusarin C (PubMed:22652150). Within the cluster, FUS1, FUS2, FUS8 and FUS9 are sufficient for fusarin production (By similarity). The other FUS cluster members are not essential for fusarin C biosynthesis (By similarity).

Belongs to the peptidase A1 family.

439 amino acids

MLTIATLHVALQVFGAFSPSHAAAVTLEHRSARDGNSVAVPANWDVYGYLFNVTVGSPPQNITMLSDMTWMAPFVRSGRCLGQFNPELCVAQGQSFFNEHNSTTFANTTFAQATWPVTAFAPNFTVDYGRDKFCIGEICNKDTLMQVSDFPYPGSVVPVIPFGGIFGLAPTPEAITATSEPVNFQAWKNGKMGPLVGWHTCEVLKSAATCQGGDAQLVFGGTDTTMYSAKKLQSYEIQNPEWLSDAFYPSTPPRSNYWSTSLTGMWIRTDKLSKNYAVPFKAVKTAKRTPPLAVVDEGSEGLGAPLSLNGYKYLVRHIKSAKLASKAIVQNIQQQGSSGYNTADQDWYTVACDGLHEYPDLVYQLDGRKKYTISAGDYVTKLTDMPGSVCYLNINVWKYGRTENGDARVVLLGRAFLKRKYLVLNFEDRSFGLAPLRTG

48.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FUS4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here