Effector that acts as a broad suppressor of cell death to interrupt plant immunity. Inhibits cell death induced by cell death-inducing proteins, including the PAMP elicitor INF1 from P.infestans.

Belongs to the RxLR effector family.

149 amino acids

MRLFYFSAMSVIGLLARNNMVVVASDKPITAVETLGNPVHLHHEVVESGLVRSLRTREKDIQDSTVAKDDAIKVEEDRSSLIQTINTPRYAYWFSQQMTPLDVRRELHLPAHKLQAKPSKVYSGYVEYYNIHCSFFKYRDEPFCCVKEY

17.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RxLR17 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here