Catalyzes the reduction of benzophenanthridines, preferentially sanguinarine, to the corresponding dihydroalkaloids. Involved in detoxifying the phytoalexins produced by plant itself. The sanguinarine produced by intact cells upon elicitation, after excretion and binding to cell wall elements, is rapidly reabsorbed and reduced to the less toxic dihydrosanguinarine. Can work with both NAD(P) or NAD as a hydrogen donor, but at low concentrations, the reaction velocity with NAD(P)H is threefold higher than with NADH. However, chelerythrine shows maximum conversion rates with NADH. The substrate preference is sanguinarine > chelerythrine > chelirubine, macarpine or 10-OH-chelerythrine. No activity with berberine or phenanthridine cations.

Belongs to the NAD(P)-dependent epimerase/dehydratase family.

273 amino acids

MADSSKKLTVLLSGASGLTGSLAFKKLKERSDKFEVRGLVRSEASKQKLGGGDEIFIGDISDPKTLEPAMEGIDALIILTSAIPRMKPTEEFTAEMISGGRSEDVIDASFSGPMPEFYYDEGQYPEQVDWIGQKNQIDTAKKMGVKHIVLVGSMGGCDPDHFLNHMGNGNILIWKRKAEQYLADSGVPYTIIRAGGLDNKAGGVRELLVAKDDVLLPTENGFIARADVAEACVQALEIEEVKNKAFDLGSKPEGVGEATKDFKALFSQVTTPF

29.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SARED1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here