Part of the cellular protein quality control system with a specific role in salt stress response. May facilitate protein homeostasis, together with chemical chaperones that accumulate during the salt stress response. Increased levels of YocM protects against both heat and salt stress. In vitro, displays an unusual aggregase chaperone activity.

Belongs to the small heat shock protein (HSP20) family.

158 amino acids

MDFEKMKQWMEFAQQMYGGDFWKQVFDEDQKTPFMTNGQSPFPFAQQDQRGKGDASFPSMDIVDTVAEVQFLIYLPGYRKQDVHILSYGDYLVVKGQRFSYFNEQDFRQKEGKYGSFEKKIPLSDHLHGKMNAIFKDGILYITIQKDEGQAKTIVIDD

18.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make yocM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here