Description
Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate (By similarity). May be involved in the synthesis of betain in response to abiotic stress such as high salinity (Ref.1).
Family
Belongs to the AdoMet synthase family.
Sequence
METFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKAEVDYEKIVRDTCRSIGFTSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGACAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVSNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRAIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKETFDFRPGMMSINLDLKRGGNGRFQKTAAYGHFGRDDPDFTWEVVKPLKWEKIPA
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service