Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Involved in chromosome stability (By similarity).

Belongs to the SWC5 family.

341 amino acids

MGKQKATRVNGILKKEEQTIDDDSLKKEKQAIDDEDYDEDEDEDYDPEAKVEEEKEASDEESDHEPQPDYSSIENATFQDRLVKTRSQRHQEKYGSNAGINHIRPGLIKSDDISKNIDVDAIFNDLQRKSKSGTPDDWKASIEEEQAKTESIKYNNANSKQTTNISSADTPQEDNSLDPQKVKIESSYTFAGKVITESKLVDAGSAEAKAYFNSTKGITASNLKASAATRSFVPIIRTIPGSTEPTELRIKLKRPSLIDKFLSTYGDKKQKLSTLEKSRLDWASFVDQKKLKDDLSTHNKGGYLDKQEFLGRLQDKRDEHYQKAKEEERKRQWQSQQQQSL

38.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SWC5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here