Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant H2A.F/Z leading to transcriptional regulation of selected genes (e.g. FLC) by chromatin remodeling. Coodinates SWR1-C, FRI-C (FLC transcription activator complex), histone methyltransferase and general transcription factors. Represses flowering by positively regulating FLC and MAF4. Binds to the promoter region of FLC chromatin.

Belongs to the ZNHIT1 family.

171 amino acids

MEEEMSNRRVSNRTRKVATKMAAALTSNDNRTQAAIARLEALENDNGAIEVIDLNDDEEASLDEDDDLGYLQKKQHKGSKRKTRQAKALEARKAPKSFLELLQEANLESLPSHVPTYLKAAVGPPSSSSRRYFCSVCGYIAGYNCCLCGMRFCSIRCQNIHKDTRCQKFVA

19.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SWC6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here