Description
Plays a redundant role in promoting the expression of calcium channel CACNA1S at the cell membrane, and thereby contributes to increased channel activity (PubMed:29467163). Slows down the inactivation rate of the calcium channel CACNA1C (PubMed:25548159, PubMed:29363593).
Sequence
MTEMSEKENEPDDAATHTPPGTVSTLQETKLQRFKRSLSLKTILRSKSVENFFLRSGSELKCPTEVLLTPPTPLPPPSPPPASTDRGLPTPTPSPCPVPRPLAPLKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKTCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHAPPPACAMNKESPPTGTSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSVFTAPAESEGSGPEEKSPGQQPPKLPLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVSRSKDSDGFIRVSSGKKRGLVPADSLAEI
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service