Possible component of the TREX-2 complex (transcription and export complex 2), a muliprotein complex that functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery.

Belongs to the SAC3 family.

406 amino acids

MNRRNRGSSSSSSRVSNTYGNRQFSDNPRTGSGGGVNESFQRRSDAPHKRNNEKDESKHKDEDPADVSLIVGTCSSMCPERERVTRERLRDLAVFERLYGNPSKSSTEIAVKKFCRTLSAADVQASDVRPLPVLEETLRYLLSLLDSKEHPFEVVHDFIFDRTRSIRQDLSIQNLANERVIYLYEEMVKFHVISHERLQSCSGTSISSMHHLNMEQLAKTLTSLYNIYDANRKPDYIYENEAEFRSLYVLLHLNPSSGVMGEPLSLWFRKLTFALVKSKEICFVRNLLRLYRMGNYKNFLSRTASEATYLQYCISEHHIREMRLVAVQYINNVCYKLQPYPLLRLSQNLKMKELDVESLCHECGLETCTDPDGFTVLPVKQSTFRSPEDKFKVYDLIGIERIKMSI

47 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SAC3C using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here