Effector that suppresses plant defense responses during the early stages of pathogen infection. Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:21653195). Is able to induced cell death in tomato, tobacco, eggplant, and potato, but not in A.thaliana (PubMed:28134441). Interacts with and destabilizes host 1-aminocyclopropane-1-carboxylate synthases. By suppressing type2 ACS-catalyzed ethylene biosynthesis, Avh238 facilitates Phytophthora infection (PubMed:30394556).

Belongs to the RxLR effector family.

134 amino acids

MRGVFFVAVAVAIFARSSAEAKLLSEAAPGLAADAVISGESRERFLRVADPEDDDLAAPADDGKTEERAPKFKSLNEIHKKLDEEDMVHVSKILGNMGAIHADNIAKARAALKAAHESGATTANQLVAGLAKPV

14.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Avh238 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here