Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule. Could be involved in hydrogenase-linked redox processes (By similarity).

Belongs to the rubredoxin family.

111 amino acids

MSEQAVENTVLDRFECRSCGYVYEPEKGDNKHDIAPETPFAELPINWRCPVCTAKKAAFTNIGPAGTASGFRENLGYGLGVNKLTPAQKNILIFGALALGFLFFISLYGLQ

12.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rub using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here