S-adenosyl-L-methionine-dependent protein-lysine N-methyltransferase that methylates 60S ribosomal protein L1.

Belongs to the class I-like SAM-binding methyltransferase superfamily. RKM5 family.

317 amino acids

MLQLCPLDEDTLYTHVYERYVELDRHAETLAQDLGIHASDAETLVVDIAPAQPTKSSDTYSLTVSQSLASLRSSTVNNNSTTGYVLWSGTPFFLCWLLYAPSAAPLRDGGRVPVTDSAAQFLQLPPLFSAPARPVCVVELGSGAAGVAAIVLANYVDRYLVSDQKAILKPLRANLLANISEVSRRTVCSKQTPELSSNRRTPARCELELIALDWERIATVPAALRPTDAAHVHVLALDVVYNDFLIPPLLTAIKRLLRWYADEHAVKATAYVLVHLRAQDILQTFLEHAIIDLRLRCYYMDEERLRSSRFALYYVTL

35.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RKM5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here