S-adenosyl-L-methionine-dependent protein-lysine N-methyltransferase that trimethylates 60S ribosomal protein L12 (RPL12A and RPL12B) at 'Lys-4' and 'Lys-11'.

Belongs to the class V-like SAM-binding methyltransferase superfamily. RKM2 family.

479 amino acids

MEGKVDVLLTWLKKSDKFYIAPNISICESPETGRGIVLSHGSIRKNDIIVSVPSSKQLNFHTILYHISKFNKELNIPGITIDRKPINYEDNIIEAENKAWADPRYGLYSELSKEFLLSLSSFQLVSFYILVENFLLPKWTHNEIYSDWKPFFDVWPSMEELRSIPAIWNCDPNSRYHSLIEYLPAASRKHMARISGLVREDWETISEVVLKWNEIYGSLSCTKNSDKFTSDELFSLFVHVYFIINSRCLYAKIPLKIEDSPSNFTLVPYVDFMNHICESDLHCYPQLSPQLRSEGENIIGIGQFTIRCGDHLYDNINEELFLNYGAHSNDFLLNEYGFVVDGNKWNYLDISDEIIELIDDDKKEVKTFLLEHDYWGDYTINETDISYRIFVALNYYVTRDERRVRKFIEGYISEDYFKPKISSVLKELLVSLTAKYTKTLSELTEKVSNLENNLCLQNLITIYKGYIKILTQHLQDLQS

56 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RKM2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here