Description
Essential component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. In the complex, RRP8 binds to H3K9me2 and probably acts as a methyltransferase. Its substrates are however unknown (By similarity).
Family
Belongs to the methyltransferase superfamily. RRP8 family.
Sequence
MFEEPEWVEAAPAIVGLGAATAQVRPATAPPVKGRKRRHLLATLRALEAASLSQQTPSLPGSDSEEEEEVGRKKRHLQRPSLASVSKEVGKKRKGKCQKQAPSISDSEGKEIRRKCHRQAPPLGGVSAGEEKGKRKCQEYSSLHLTQPLDSVDQTVHNSRTSTATIDPSKPSPESMSPNSSHTLSRKQWRNRQKNKRRHKNKFRPLQTPEQAPPKASIEETEVPPVPKSDSQESRAGALRARMTQRLDGARFRYLNEQLYSGPSSAARRLFQEDPEAFLLYHRGFQRQVKKWPLHPVDRIAKDLRQKPASLVVADFGCGDCRLASSVRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKTGGLLKVAEVSSRFEDIRTFLGAVTKLGFKIIYKDLTNSHFFLFDFEKTGPPRVGPKAQLSGLKLQPCLYKRR
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service