About Products Protein Database Contact

Protein expression services for rsmA | Ribosomal RNA small subunit methyltransferase A

Description
Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits.
Family
Belongs to the class I-like SAM-binding methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. RsmA subfamily.
Species
Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Length
262 amino acids
Sequence
MNSSFSAPAKKSLGQHFLADRYYIDRIVQAVDPRPGQHLVEIGPGQGAITFPLLRKHGALTVIEFDRDLIAPLTDAAAPIGQLQIIHRDVLAVDFTAVADGTPIRLVGNLPYNISSPILFHALDHAGAVADMHFMLQKEVVDRMAAGPGSKVYGRLSVMLQAYCEVTALFVVPPGAFRPPPKVDSAVVRLVPRDAASVLIKDRKRFADVVRAGFGQRRKTLRNALSTVCEPAHFEAAGVRPDARAEQLEVADFIRLANVELA
Mass
28.5 kDa
Simulated SDS-PAGE
Western blot of rsmA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rsmA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here