Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits.

Belongs to the class I-like SAM-binding methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. RsmA subfamily.

273 amino acids

MTDLPPLRDVVNRHGLYATKALGQNFLFDEQLLDRIARVPGKLKGENVLEVGPGPGGLTRALLRAGAKVTAIEMDKRCLPALAELADAFPGQLTVIEGDATKIAPETLFDGPWHVAANLPYNVGTQLFTGWLSGQDWPPQWKSLTLMFQLEVAERIVAQPGTDAYGRLAVLAQWRATPRIATRVHRSAFTPPPKVMSAIIHVEPAAMPEGVSARMLERVTEAAFGQRRKMLRQSLKGLPGALDALETLGIDPQRRAETLSVEDFVAIARLLTK

29.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rsmA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here