Specifically methylates the cytosine at position 1962 (m5C1962) of 23S rRNA.

Belongs to the methyltransferase superfamily. RlmI family.

400 amino acids

MTDSLFPRLVLAKGREKSLLRRHPWIFSGGVARMEGKARSGETIDIVDHQGKWLARGAYSPSSQIRARVWTFDRNEAIDSAFFERRLQQAQTWRAWLAERDGLDSYRLIAGESDGLPGVTIDRFGNFFVLQLLSAGAEYQRAAIISALQNLFPDCAIYDRSDVAVRKKEGLELAQGPVVGELPPALLPITEHGMKLLVDIQGGHKTGYYLDQRDSRLATRRYVADKRVLNCFSYTGGFAVSALMGGCRQVTSVDTSQEALDVARQNVELNGLDLSKAEFVRDDVFKLLRKYRDQGEKFDVIVMDPPKFVENKSQLMGACRGYKDINMLAIQLLNPGGVLLTFSCSGLMTTDLFQKIIADAAIDAGRDVQFIEQFRQAADHPVIATYPEGLYLKGFACRVM

44.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rlmI using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here