Involved in the biosynthesis of the central metabolite phospho-alpha-D-ribosyl-1-pyrophosphate (PRPP) via the transfer of pyrophosphoryl group from ATP to 1-hydroxyl of ribose-5-phosphate (Rib-5-P).

Belongs to the ribose-phosphate pyrophosphokinase family. Class I subfamily.

326 amino acids

MSEQYFDPKLKIFALNSNKPLAEKIADAVGVKLGKTSVDRFSDGEIRINIEESIRGDQVYIIQSTSAPVNDNLMELLIMIDALRRASAKTINVVIPYYGYARQDRKARSREPITAKLVANMLETAGATRILALDLHAAQIQGFFDIPLDHLMGAPLLADYFLNHHLDENAVVVSPDHGGVTRARKLAEFLKAPIAIIDKRRPRANVAEVMNIIGDVKGKRAIMIDDMIDTAGTITLGAQALVDAGATEVYASCTHPVLSGPAIERIEKSPIKKLVVTDSIELPAAKRIDKIEQVSVGQLMGQAIKFIHENKPVSPLFKNRFHNEEN

35.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make prs1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here