Catalyzes the isomerization of ribose 1,5-bisphosphate (R15P) to ribulose 1,5-bisphosphate (RuBP), the CO(2) acceptor and substrate for RubisCO. Only accepts the alpha-anomer of D-ribose 1,5-bisphosphate as substrate, being inactive on the beta-anomer. Displays a strict substrate specificity, since other phosphorylated sugars such as R5P, ribose, G16P, G6P, G1P, FBP, F6P, and PRPP, are not substrates. Functions in an archaeal AMP degradation pathway, together with AMP phosphorylase and RubisCO.

Belongs to the eIF-2B alpha/beta/delta subunits family. R15P isomerase subfamily.

322 amino acids

MAVVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHCHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED

36.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TK0185 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here