Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides (By similarity).

Belongs to the ribonucleoside diphosphate reductase small chain family.

340 amino acids

MAANNKKYFLESFSPLGYVKNNFQGNLRSVNWNLVDDEKDLEVWNRIVQNFWLPEKIPVSNDIPSWKKLSKDWQDLITKTFTGLTLLDTIQATIGDICQIDHALTDHEQVIYANFAFMVGVHARSYGTIFSTLCTSEQINAAHEWVVNTESLQKRAKALIPYYTGNDPLKSKVAAALMPGFLLYGGFYLPFYLSSRKQLPNTSDIIRLILRDKVIHNYYSGYKYQRKLEKLPLAKQKEMKAFVFELMYRLIELEKDYLKELYEGFGIVDDAIKFSVYNAGKFLQNLGYDSPFTAAETRIKPEIFAQLSARADENHDFFSGNGSSYVMGVSEETNDDDWNF

39.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nrdF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here