Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single-stranded and double-stranded RNA (By similarity).

Belongs to the pancreatic ribonuclease family.

156 amino acids

MGLEKSLVFFPLLVLLALGWVQPCLGRESSAHKFRRQHMDSEGLSSSSSSPTYCNQMMQRRKLTRGHCKPVNTFVHEPLADVQAVCFQENVTCKNGQTNCYRSGSSMHVTDCRTTGSSKYPNCAYRTTQKVKRIVVACEGDPSVPVHYDGSVEDST

17.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RNASE1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here