Protein expression services for AAE3_01767 | Ribonuclease ageritin
Description
Ribonuclease which cleaves 28S RNA in eukaryotic ribosomes and shows antitumor activity (PubMed:28232091, PubMed:30262416). Its toxic action on eukaryotic cells is the result of cleavage of a single phosphodiester bond in the 28S subunit of ribosomes (PubMed:28232091, PubMed:30262416). Exerts cytotoxicity and induces apoptosis towards rat glial cells and human glioma cells, and also displays some activity towards human neurolastoma cell lines (PubMed:28232091).
Family
Belongs to the ribotoxin-like family.
Species
Agrocybe aegerita
Length
136 amino acids
Sequence
MAETVQYYNSYSDASIASCAFVDSGKDKIDKTKLVTYTSRLAASPAYQKVVGVGLKTAAGSIVPYVRLDMDNTGKGIHFNATKLSDSSAKLAAVLKTTVSMTEAQRTQLYMEYIKGIENRSAQFIWDWWRTGVAPT
Mass
14.9 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make AAE3_01767 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here