About Products Protein Database Contact

Protein expression services for RNASE6 | Ribonuclease K3

Description
Ribonuclease which shows a preference for the pyrimidines uridine and cytosine (PubMed:7764367). Has potent antibacterial activity against a range of Gram-positive and Gram-negative bacteria, including P.aeruginosa, A.baumanii, M.luteus, S.aureus, E.faecalis, E.faecium, S.saprophyticus and E.coli (By similarity). Causes loss of bacterial membrane integrity, and also promotes agglutination of Gram-negative bacteria (By similarity). Probably contributes to urinary tract sterility (By similarity). Bactericidal activity is independent of RNase activity (By similarity).
Family
Belongs to the pancreatic ribonuclease family.
Species
Sus scrofa
Length
153 amino acids
Sequence
MGPDLRCFPLLLLLLGLWWSVRPLCAIPKNLTRAQWFTIQHIQPSPLQCNKAMNSVNNYTWHCKPQNTFLHDSFQDVATACNLPNITCKNGQNNCHQSAKPVSLTQCSFTGGNYPNCRYKDAAQYKFFIVACDPPQKGDPPYPFVPVHLDKII
Mass
17.4 kDa
Simulated SDS-PAGE
Western blot of RNASE6 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make RNASE6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here