Rhomboid-type serine protease that catalyzes intramembrane proteolysis. May be involved in TIC22 processing during its import.

Belongs to the peptidase S54 family.

280 amino acids

MSQLLHLHRLSLPQSSLRFRFPPLHRRRAASSPTNSTQPPLQFRPLTVSRSQITCRFSQSDITPQFELDKAKDNRKPQKRANGIFWIILINLGIYLADHFFQVRGIKSLYLYHNFPAWYQFVTATFCHANWNHLSSNLFFLYIFGKLVEEEEGNFGLWLSYLFTGVGANLVSWLVLPRNAVSVGASGAVFGLFAISVLVKMSWDWRKILEVLILGQFVIERVMEAAQASAGLSGTIYGGYSLQTVNHIAHLSGALVGVVLVWLLSKFPSASMDQDVKKSS

31.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RBL11 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here